PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00014510001
Common NameGSBRNA2T00014510001, LOC106351721, LOC106434339
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 239aa    MW: 24969.6 Da    PI: 9.0502
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00014510001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.7e-382686262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         ++++l+cprC+stntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGgg+rk  k+s
  GSBRNA2T00014510001 26 QQEQLPCPRCNSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGGTRKAAKRS 86
                         68999***************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-292484IPR003851Zinc finger, Dof-type
PfamPF027015.6E-332884IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9753084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0042545Biological Processcell wall modification
GO:0045787Biological Processpositive regulation of cell cycle
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MTTTSNTNAM RLHGVITGNP PPATEQQEQL PCPRCNSTNT KFCYYNNYNF SQPRHFCKSC  60
RRYWTHGGTL RDIPVGGGTR KAAKRSRTCS SSAGSRSVPL QATPVLFPQS SISNGVSHTV  120
TAPLDGKGSA LSLSGSFTSL LNQNATATHG SGSVLGIGLG SGYDDVSFGL GRAVWPFSTV  180
GDAGTTNVGS NGGHQGVVTI PATWQFEGLE TNNAGGFVSG EYFAWPDLSI TTSGNSHK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00402DAPTransfer from AT3G50410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893791e-104AC189379.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB049N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013591242.11e-175PREDICTED: dof zinc finger protein DOF3.4 isoform X1
RefseqXP_013646931.11e-175PREDICTED: dof zinc finger protein DOF3.4-like
RefseqXP_013730637.11e-175PREDICTED: dof zinc finger protein DOF3.4-like
SwissprotQ390881e-109DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLA0A078IZQ41e-175A0A078IZQ4_BRANA; BnaC01g42310D protein
TrEMBLA0A0D3A9Q31e-175A0A0D3A9Q3_BRAOL; Uncharacterized protein
STRINGBra030010.1-P1e-169(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.11e-105OBF binding protein 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]